PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 241aa    MW: 26172.4 Da    PI: 9.1436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018525genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.5e-161457144
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +g+WTteEd++l   ++++G+g+W+t ++  g+ R++k+c++rw
      Lus10018525 14 KGPWTTEEDQKLTSFIQLHGPGNWRTLPKNAGLQRCGKSCRLRW 57
                     79****************************************** PP

2Myb_DNA-binding285e-0956792347
                     -HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 23 tWktIartmgkgRtlkqcksrwqky 47
                     +W++Ia++++ gRt++++k++w+++
      Lus10018525 56 RWSAIAARLP-GRTDNEIKNYWNTH 79
                     4*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-19557IPR009057Homeodomain-like
PROSITE profilePS5129418.687965IPR017930Myb domain
SMARTSM007172.8E-151382IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-181481IPR009057Homeodomain-like
PfamPF002491.0E-131457IPR001005SANT/Myb domain
CDDcd001674.26E-131680No hitNo description
Gene3DG3DSA:1.10.10.608.2E-135881IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRTPCCDKN GLKKGPWTTE EDQKLTSFIQ LHGPGNWRTL PKNAGLQRCG KSCRLRWSAI  60
AARLPGRTDN EIKNYWNTHI RKRLLRNGID PVTHAPRLDV LDLSAILGSA LCNVTPAASL  120
LSLLAGAGQA QQQQLFNPEL LRLAAALGSL NQQFPMNHQN AQTAPSQQIQ QQQQADMAGL  180
QEFGNNNNSG GSQQKSLVSV PEDFGFWNTI PELTDNCQTN FQSNNGGGGG FKFFGSEGKS  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006469819.16e-77PREDICTED: transcription factor MYB35
TrEMBLV4W3V42e-76V4W3V4_9R
STRINGPOPTR_0019s14070.12e-74(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-65MYB-like 102